AP1B1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• AP1B1 Recombinant monoclonal antibody (87859-2-RR)

• 

  WB analysis of HEK-293 using 87859-2-RR

  WB result of AP1B1 antibody (87859-2-RR; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-AP1B1 transfected HEK-293 cells.

• 

  WB analysis using 87859-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87859-2-RR (AP1B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 87859-2-RR

  IP result of anti-AP1B1 (IP:87859-2-RR, 4ug; Detection:87859-2-RR 1:3000) with HEK-293 cells lysate 1560 ug.

• 

  IF Staining of HepG2 using 87859-2-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using AP1B1 antibody (87859-2-RR, Clone: 253524D8 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity of 87859-2-RR

  Biolayer interferometry (BLI) kinetic assays of 87859-2-RR against Human AP1B1 were performed. The affinity constant is 0.356 nM.

• KD/KO Validated

AP1B1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, IP, ELISA

Cat No. 87859-2-RR

Clone No.253524D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

Adaptor protein complex AP-1 subunit beta-1, Adaptor-related protein complex 1 subunit beta-1, ADTB1, AP 1 complex subunit beta 1, AP-1 complex subunit beta-1

---

Tested Applications

• Positive WB detected in: HT-29 cells, HEK-293 cells, HeLa cells, A431 cells
• Positive IP detected in: HEK-293 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87859-2-RR targets AP1B1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10417

  Product name: Recombinant human AP1B1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 671-919 aa of BC046242

  Sequence: NFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTLSLKCRAPEVSQHVYQAYETILKN

• Full Name: adaptor-related protein complex 1, beta 1 subunit
• Calculated Molecular Weight: 919 aa, 101 kDa
• Observed Molecular Weight: 101 kDa
• GenBank Accession Number: BC046242
• Gene Symbol: AP1B1
• Gene ID (NCBI): 162
• RRID: AB_3745793
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q10567
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP1B1 is a subunit of the adaptor complex AP-1 and is a member of the adaptin protein family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors.