Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

AP1M2 Polyclonal antibody

AP1M2 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

AP1 mu2, AP-1 complex subunit mu-2, AP mu chain family member mu1B, AP 1 complex subunit mu 2, Adaptor-related protein complex 1 subunit mu-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for AP1M2 in ?

Tested Applications

Positive WB detected inmouse colon tissue, Hacat cells
Positive IHC detected inhuman pancreas cancer tissue, human kidney tissue, human bowen disease
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10618-1-AP targets AP1M2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0961

Product name: Recombinant human AP1M2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-320 aa of BC005021

Sequence: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYLVATTSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGLSGSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPS

Predict reactive species
Full Name adaptor-related protein complex 1, mu 2 subunit
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC005021
Gene Symbol AP1M2
Gene ID (NCBI) 10053
RRIDAB_2242895
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y6Q5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP1M2 is a subunit of the adaptor complex AP-1. It belongs to the adaptor complexes medium subunit family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors.

Protocols

Product Specific Protocols
IHC protocol for AP1M2 antibody 10618-1-APDownload protocol
WB protocol for AP1M2 antibody 10618-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The AP1M2 Polyclonal antibody (Cat# 10618-1-AP) has 3 total citations published in Nature Communications, Journal of Biological Chemistry, and Gene. The cited research spans post-Golgi vesicular transport and endosome maturation, clathrin adaptor AP-1-mediated Golgi export of amyloid precursor protein in neurodegeneration, and AP1M2's role in hepatocellular carcinoma growth via JNK/ERK signaling pathway regulation.

SpeciesApplicationTitle

Nat Commun

Reversible control of post-Golgi transport by brefeldin A reveals recycling endosome maturation during glycosylphosphatidylinositol-anchored protein transport.

Authors - Arata Takiguchi
WB

J Biol Chem

Clathrin adaptor AP-1-mediated Golgi export of amyloid precursor protein is crucial for the production of neurotoxic amyloid fragments.

Authors - Yunan C Januário
humanWB

Gene

Deciphering the influence of AP1M2 in modulating hepatocellular carcinoma growth and Mobility through JNK/ErK signaling pathway control

Authors - Huan Wang
Loading...
||
New chat

Able™

正在加载,请稍候...