Use Able AI chat for product recommendations

AP2S1 Polyclonal antibody, PBS Only

AP2S1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15634-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

15634-1-PBS targets AP2S1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8095

Product name: Recombinant human AP2S1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-142 aa of BC006337

Sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Predict reactive species
Full Name adaptor-related protein complex 2, sigma 1 subunit
Calculated Molecular Weight 142 aa, 17 kDa
Observed Molecular Weight15-17 kDa
GenBank Accession NumberBC006337
Gene Symbol AP2S1
Gene ID (NCBI) 1175
RRIDAB_3669216
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP53680
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

AP2S1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 is composed of two large adaptins (alpha-type subunit AP2A1 or AP2A2 and beta-type subunit AP2B1), a medium adaptin (mu-type subunit AP2M1), and a small adaptin (sigma-type subunit AP2S1). It works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis. Missense mutations of AP2S1 affect Arg15 and lead to familial hypocalciuric hypercalcemia type 3 (FHH3), an extracellular calcium homeostasis disorder affecting the parathyroids, kidneys, and bone (PMID: 23222959).

Loading...
||
New chat

Able

正在加载,请稍候...