AP3M1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AP3M1 Polyclonal antibody, PBS Only (12114-1-PBS)

• 

  WB analysis using 12114-1-AP (same clone as 12114-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12114-1-AP (AP3M1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12114-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12114-1-AP (same clone as 12114-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12114-1-AP (AP3M1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12114-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 12114-1-AP (same clone as 12114-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12114-1-AP (AP3M1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12114-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 12114-1-AP (same clone as 12114-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12114-1-AP (AP3M1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12114-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12114-1-AP (same clone as 12114-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using AP3M1 antibody (12114-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 12114-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AP3M1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12114-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

12114-1-PBS targets AP3M1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2759

  Product name: Recombinant human AP3M1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 219-418 aa of BC026232

  Sequence: SLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT

• Full Name: adaptor-related protein complex 3, mu 1 subunit
• Calculated Molecular Weight: 418 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC026232
• Gene Symbol: AP3M1
• Gene ID (NCBI): 26985
• RRID: AB_2289629
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2T2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP3M1 is a subunit of the AP-3 complex which is composed of two large adaptins (AP3D1 and AP3B1 or AP3B2), a medium adaptin (AP3M1 or AP3M2) and a small adaptin (APS1 or AP3S2). AP-3 complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.