AP50 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AP50 Polyclonal antibody, PBS Only (27355-1-PBS)

• 

  WB analysis using 27355-1-AP (same clone as 27355-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27355-1-AP (AP50 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27355-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 27355-1-AP (same clone as 27355-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27355-1-AP (AP50 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27355-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 27355-1-AP (same clone as 27355-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 27355-1-AP (AP50 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27355-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 27355-1-AP (same clone as 27355-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 27355-1-AP (AP50 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27355-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 27355-1-AP (same clone as 27355-1-PBS)

  IP result of anti-AP50 (IP:27355-1-AP, 4ug; Detection:27355-1-AP 1:1000) with mouse brain tissue lysate 2120 ug. This data was developed using the same antibody clone with 27355-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 27355-1-AP (same clone as 27355-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27355-1-AP (AP50 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27355-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 27355-1-AP (same clone as 27355-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27355-1-AP (AP50 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27355-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AP50 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 27355-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

AP2M1, Adaptin mu2, Adaptin-mu2, Adaptor protein complex AP-2 subunit mu, Adaptor-related protein complex 2 subunit mu

---

Product Information

27355-1-PBS targets AP50 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26059

  Product name: Recombinant human AP50 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-110 aa of BC013796

  Sequence: MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYE

• Full Name: adaptor-related protein complex 2, mu 1 subunit
• Calculated Molecular Weight: 433 aa, 49 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC013796
• Gene Symbol: AP50
• Gene ID (NCBI): 1173
• RRID: AB_2880853
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CW1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.