APBB2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• APBB2 Polyclonal antibody, PBS Only (13177-1-PBS)

• 

  WB analysis of human brain using 13177-1-AP (same clone as 13177-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 13177-1-AP (APBB2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 13177-1-AP (same clone as 13177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13177-1-AP (same clone as 13177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 13177-1-AP (same clone as 13177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 13177-1-AP (same clone as 13177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 13177-1-AP (same clone as 13177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 13177-1-AP (same clone as 13177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13177-1-AP (APBB2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13177-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13177-1-AP (same clone as 13177-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 13177-1-AP (APBB2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13177-1-PBS in a different storage buffer formulation.

APBB2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13177-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FE65L, FE65L1, A4, Amyloid-beta, Protein Fe65 like 1

---

Product Information

13177-1-PBS targets APBB2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3844

  Product name: Recombinant human APBB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 386-736 aa of BC027946

  Sequence: SCSINSDPEAKCFAVRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALACSSLQERANVNLDVPLQDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP

• Full Name: amyloid beta (A4) precursor protein-binding, family B, member 2
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 83-95 kDa
• GenBank Accession Number: BC027946
• Gene Symbol: APBB2
• Gene ID (NCBI): 323
• RRID: AB_10638434
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92870
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.