Product Information
20409-1-PBS targets APC15 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14237 Product name: Recombinant human C11orf51 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC005156 Sequence: MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI Predict reactive species |
| Full Name | chromosome 11 open reading frame 51 |
| Calculated Molecular Weight | 121 aa, 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC005156 |
| Gene Symbol | APC15 |
| Gene ID (NCBI) | 25906 |
| RRID | AB_10694279 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60006 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |























