APC15 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• APC15 Polyclonal antibody, PBS Only (20409-1-PBS)

• 

  WB analysis of HT-29 using 20409-1-AP (same clone as 20409-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 20409-1-AP (APC15 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 20409-1-AP (same clone as 20409-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20409-1-AP (APC15 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 20409-1-AP (same clone as 20409-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 20409-1-AP (APC15 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 20409-1-AP (same clone as 20409-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 20409-1-AP (APC15 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 20409-1-AP (same clone as 20409-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 20409-1-AP (APC15 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse adrenal gland using 20409-1-AP (same clone as 20409-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse adrenal gland tissue slide using 20409-1-AP (APC15 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 20409-1-AP (same clone as 20409-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 20409-1-AP (APC15 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 20409-1-AP (same clone as 20409-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 20409-1-AP (APC15 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat adrenal gland using 20409-1-AP (same clone as 20409-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat adrenal gland tissue slide using 20409-1-AP (APC15 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 20409-1-AP (same clone as 20409-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 20409-1-AP (APC15 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 20409-1-AP (same clone as 20409-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 20409-1-AP (C11orf51 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 20409-1-AP (same clone as 20409-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 20409-1-AP (C11orf51 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20409-1-PBS in a different storage buffer formulation.

APC15 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20409-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

C11orf51, HSPC020, Anaphase-promoting complex subunit 15, ANAPC15

---

Product Information

20409-1-PBS targets APC15 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14237

  Product name: Recombinant human C11orf51 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-121 aa of BC005156

  Sequence: MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI

• Full Name: chromosome 11 open reading frame 51
• Calculated Molecular Weight: 121 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC005156
• Gene Symbol: APC15
• Gene ID (NCBI): 25906
• RRID: AB_10694279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60006
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.