APCDD1 Polyclonal antibody

• 

  WB analysis using 17024-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17024-1-AP (APCDD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 17024-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 17024-1-AP (APCDD1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 17024-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 17024-1-AP (APCDD1 Antibody) at dilution of 1:50 (under 40x lens).

APCDD1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17024-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

APCDD1, B7323, DRAPC1, FP7019, Protein APCDD1

---

Tested Applications

• Positive WB detected in: COLO 320 cells, Raji cells, mouse brain tissue, mouse heart tissue, mouse skin tissue
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

17024-1-AP targets APCDD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10303

  Product name: Recombinant human APCDD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 141-496 aa of BC053324

  Sequence: TEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYGRAPGRHTWSL

• Full Name: adenomatosis polyposis coli down-regulated 1
• Calculated Molecular Weight: 514 aa, 59 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC053324
• Gene Symbol: APCDD1
• Gene ID (NCBI): 147495
• RRID: AB_3085513
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8J025
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

APCDD1(adenomatosis polyposis coli down-regulated 1) is a membrane-bound glycoprotein conserved during vertebrate evolution that regulates important biological processes controlled by Wnt signaling (PMID: 26170146). APCDD1 is a membrane-bound glycoprotein that is abundantly expressed in human HFs (hair follicles) and can interact in vitro with WNT3A and LRP5, two essential components of Wnt signaling (PMID: 20393562). APCDD1 may be modified by glycosylation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Sci Rep; Gestational high-sucrose diet mediated vascular hyper-contractility in mesenteric arteries from offspring; Authors - Xinying Liu