APH1B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• APH1B Polyclonal antibody, PBS Only (28175-1-PBS)

• 

  WB analysis using 28175-1-AP (same clone as 28175-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28175-1-AP (APH1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28175-1-PBS in a different storage buffer formulation.

APH1B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28175-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

APH 1B, Aph 1beta, APH-1b, Aph-1beta, Gamma secretase subunit APH 1B

---

Product Information

28175-1-PBS targets APH1B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14066

  Product name: Recombinant human APH1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 196-257 aa of BC020905

  Sequence: HLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR

• Full Name: anterior pharynx defective 1 homolog B (C. elegans)
• Calculated Molecular Weight: 257 aa, 28 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC020905
• Gene Symbol: APH1B
• Gene ID (NCBI): 83464
• RRID: AB_3742281
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WW43
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.