APLP2 Recombinant monoclonal antibody

APLP2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 84703-3-RR
Clone No.241655G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

241655G7, A4, Amyloid beta, Amyloid beta precursor like protein 2, Amyloid like protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat brain tissue, mouse brain tissue, SH-SY5Y cells, HEK-293 cells
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84703-3-RR targets APLP2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6842

Product name: Recombinant human APLP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 33-360 aa of BC000373

Sequence: YIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIGSVSKEEEEEDEEEEEEEDEEEDYDVYKSEFPTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC

Predict reactive species
Full Name amyloid beta (A4) precursor-like protein 2
Calculated Molecular Weight 87 kDa
Observed Molecular Weight95-120 kDa
GenBank Accession NumberBC000373
Gene Symbol APLP2
Gene ID (NCBI) 334
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ06481
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Amyloid precursor-like protein-2 (APLP2) is a member of the APP (amyloid precursor protein) family including APP, APLP1, and APLP2. APLP2 is ubiquitously expressed. It contains heparin-, copper- and zinc- binding domains at the N-terminus, BPTI/Kunitz inhibitor and E2 domains in the middle region, and transmembrane and intracellular domains at the C-terminus. APLP2 has been shown to regulate multiple cellular functions such as neurite outgrowth, axogenesis, corneal epithelial wound healing, cell adhesion, migration, and mitosis. The synergy of this protein and the APP is required to mediate neuromuscular transmission, spatial learning and synaptic plasticity. APLP2 has been implicated in the pathogenesis of Alzheimer's disease.

Protocols

Product Specific Protocols
IF protocol for APLP2 antibody 84703-3-RRDownload protocol
WB protocol for APLP2 antibody 84703-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...