APLP2 Recombinant monoclonal antibody

• 

  WB analysis using 84703-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84703-3-RR (APLP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of SH-SY5Y using 84703-3-RR

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using APLP2 antibody (84703-3-RR, Clone: 241655G7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84703-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84703-3-RR against Human APLP2 were performed. The affinity constant is 0.675 nM.

APLP2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84703-3-RR

Clone No.241655G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

241655G7, A4, Amyloid beta, Amyloid beta precursor like protein 2, Amyloid like protein 2

---

Tested Applications

• Positive WB detected in: rat brain tissue, mouse brain tissue, SH-SY5Y cells, HEK-293 cells
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84703-3-RR targets APLP2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6842

  Product name: Recombinant human APLP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 33-360 aa of BC000373

  Sequence: YIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIGSVSKEEEEEDEEEEEEEDEEEDYDVYKSEFPTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC

• Full Name: amyloid beta (A4) precursor-like protein 2
• Calculated Molecular Weight: 87 kDa
• Observed Molecular Weight: 95-120 kDa
• GenBank Accession Number: BC000373
• Gene Symbol: APLP2
• Gene ID (NCBI): 334
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q06481
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Amyloid precursor-like protein-2 (APLP2) is a member of the APP (amyloid precursor protein) family including APP, APLP1, and APLP2. APLP2 is ubiquitously expressed. It contains heparin-, copper- and zinc- binding domains at the N-terminus, BPTI/Kunitz inhibitor and E2 domains in the middle region, and transmembrane and intracellular domains at the C-terminus. APLP2 has been shown to regulate multiple cellular functions such as neurite outgrowth, axogenesis, corneal epithelial wound healing, cell adhesion, migration, and mitosis. The synergy of this protein and the APP is required to mediate neuromuscular transmission, spatial learning and synaptic plasticity. APLP2 has been implicated in the pathogenesis of Alzheimer's disease.