APOBEC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• APOBEC1 Polyclonal antibody, PBS Only (32857-1-PBS)

• 

  WB analysis using 32857-1-AP (same clone as 32857-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32857-1-AP (APOBEC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32857-1-PBS in a different storage buffer formulation.

APOBEC1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32857-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

APO1, APOBEC-1, Apolipoprotein B mRNA-editing enzyme 1, Apolipoprotein B mRNA-editing enzyme catalytic subunit 1, C->U-editing enzyme APOBEC-1

---

Product Information

32857-1-PBS targets APOBEC1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26715

  Product name: Recombinant human APOBEC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of NM_001304566

  Sequence: MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLV

• Full Name: apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NM_001304566
• Gene Symbol: APOBEC1
• Gene ID (NCBI): 339
• RRID: AB_3742765
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P41238
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Apolipoprotein B mRNA-editing enzyme catalytic subunit 1 (APOBEC1) is a member of the cytidine deaminase enzyme family. It forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP) (PMID: 30844405). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs (PMID: 24916387; 11727199). APOBEC1 plays a crucial role in RNA editing, which is essential for the proper function of these proteins. Additionally, APOBEC1 has been implicated in various cellular processes, including the regulation of gene expression and the maintenance of genomic stability (PMID: 33094286).