Apolipoprotein C1/APOC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Apolipoprotein C1/APOC1 Polyclonal antibody, PBS Only (16775-1-PBS)

• 

  IHC staining of human lung cancer using 16775-1-AP (same clone as 16775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16775-1-AP (Apolipoprotein C1/APOC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 16775-1-AP (same clone as 16775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16775-1-AP (Apolipoprotein C1/APOC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 16775-1-AP (same clone as 16775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 16775-1-AP (Apolipoprotein C1/APOC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 16775-1-AP (same clone as 16775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 16775-1-AP (Apolipoprotein C1/APOC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 16775-1-AP (same clone as 16775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16775-1-AP (Apolipoprotein C1/APOC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 16775-1-AP (same clone as 16775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 16775-1-AP (Apolipoprotein C1/APOC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16775-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Apolipoprotein C1/APOC1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 16775-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

APOC1, APOC1B, Apo-CI, ApoC-I, Apolipoprotein C1

---

Product Information

16775-1-PBS targets Apolipoprotein C1/APOC1 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10119

  Product name: Recombinant human APOC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-83 aa of BC055093

  Sequence: MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS

• Full Name: apolipoprotein C-I
• Calculated Molecular Weight: 83 aa, 9 kDa
• GenBank Accession Number: BC055093
• Gene Symbol: APOC1
• Gene ID (NCBI): 341
• RRID: AB_2878314
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02654
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.