APOE Monoclonal antibody, PBS Only

Name: APOE Monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 66830-1-PBS-100UG

APOE Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66830-1-PBS

Clone No. 1B2C9

Publications (1)

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

1B2C9, Apo E, Apo-E, apoe4, apolipoprotein E

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICCFC (Intra)

WB analysis of human plasma using 66830-1-Ig (same clone as 66830-1-PBS)
human plasma was subjected to SDS PAGE followed by western blot with 66830-1-Ig (APOE antibody) at a range of dilutions from 1:5000 to 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66830-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 66830-1-Ig (same clone as 66830-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66830-1-Ig (APOE antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66830-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 66830-1-Ig (same clone as 66830-1-PBS)
WB result of APOE antibody (66830-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-APOE transfected HepG2 cells. This data was developed using the same antibody clone with 66830-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 66830-1-Ig (same clone as 66830-1-PBS)
human plasma were subjected to SDS PAGE followed by western blot with 66830-1-Ig (APOE antibody) at dilution of 1:3400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66830-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human blood using 66830-1-Ig (same clone as 66830-1-PBS)
human blood was subjected to SDS PAGE followed by western blot with 66830-1-Ig (APOE antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66830-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 66830-1-Ig (same clone as 66830-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66830-1-Ig (APOE antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66830-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 66830-1-Ig (same clone as 66830-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using APOE antibody (66830-1-Ig, Clone: 1B2C9 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66830-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of HepG2 using 66830-1-Ig (same clone as 66830-1-PBS)
1x10^6 HepG2 cells were intracellularly stained with 0.8 ug APOE Monoclonal antibody (66830-1-Ig, Clone:1B2C9) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.8 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Intracellular Staining Permeabilization Wash Buffer. This data was developed using the same antibody clone with 66830-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HepG2 cells were intracellularly stained with 0.8 ug APOE Monoclonal antibody (66830-1-Ig, Clone:1B2C9) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.8 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Intracellular Staining Permeabilization Wash Buffer. This data was developed using the same antibody clone with 66830-1-PBS in a different storage buffer formulation.

Able AI

What's the best dilution for APOE in ?

Overview

Tested Applications
Product Information
Publications (1)

Print datasheet

MSDS SDS

Product Information

66830-1-PBS targets APOE in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag28186 Product name: Recombinant human APOE protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 66-317 aa of BC003557 Sequence: QEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH Predict reactive species
Full Name	Apolipoprotein E
Calculated Molecular Weight	36 kDa
Observed Molecular Weight	34-36 kDa
GenBank Accession Number	BC003557
Gene Symbol	APOE
Gene ID (NCBI)	348
RRID	AB_2882173
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P02649
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

The apolipoprotein E (APOE) is a 299-amino acid polypeptide that mediates the binding, internalization, and catabolism of lipoprotein particles, and also serve as a ligand for the LDL (APO B/E) receptor and for the specific APOE receptor (chylomicron remnant) of hepatic tissues. The very strong association of the APOE ɛ4 allele with AD risk and its role in the accumulation of amyloid β in brains of people and animal models solidify the biological relevance of APOE isoforms but do not provide mechanistic insight.

Publications

What published studies show

The APOE Monoclonal antibody (1B2C9), catalog number 66830-1-PBS, has 1 indexed citation. It appears in Exploration (Beijing) (IF 30.4), published in 2026 by Shumin Li et al., studying hepatic mechanisms and therapeutic targets underlying hypercoagulation in obesity through genetic and transcriptomic analyses. The research field encompasses lipid metabolism, cardiovascular disease, and obesity-related coagulation disorders.

All (1)

Species	Application	Title
		Exploration (Beijing) Hepatic Mechanisms and Therapeutic Target Underpinning Hypercoagulation in Obesity: Insights From Genetic and Transcriptomic Analyses. Authors - Shumin Li View Article