APOH Recombinant monoclonal antibody, PBS Only (Detector)

APOH Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84943-2-PBS
Clone No.242454E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Apolipoprotein H, 242454E4, Activated protein C-binding protein, Apo H, Apo-H

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84943-2-PBS targets APOH as part of a matched antibody pair:

MP01667-1: 84943-1-PBS capture and 84943-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3084

Product name: Recombinant Human APOH protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 20-345 aa of NM_000042.2

Sequence: GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Predict reactive species
Full Name apolipoprotein H (beta-2-glycoprotein I)
Calculated Molecular Weight38 kDa
Observed Molecular Weight 43-55 kDa
GenBank Accession NumberNM_000042.2
Gene Symbol APOH
Gene ID (NCBI) 350
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02749
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Apolipoprotein H (ApoH), also known as beta2-glycoprotein I (B2-GPI), is a plasma glycoprotein, primarily synthesized in the liver. It has an important function in blood coagulation and clearance of apoptotic bodies from the circulation. ApoH is also an important actor of host innate immune response through its capacity to bind with high affinity to a large panel of pathogens or their proteins. ApoH is a 54 kDa plasma glycoprotein.

Loading...
||
New chat Able
正在加载,请稍候...