APOL3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87202-1-RR (same clone as 87202-1-PBS)

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 87202-1-RR (APOL3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87202-1-PBS in a different storage buffer formulation.

APOL3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87202-1-PBS

Clone No.252351G6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

APOLIII, ApoL-III, Apolipoprotein L3, CG12_1

---

Product Information

87202-1-PBS targets APOL3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29687

  Product name: Recombinant human APOL3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 246-380 aa of NM_145640

  Sequence: SSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYESKHLHEGAKSASAEELRRQAQ

• Full Name: apolipoprotein L, 3
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: NM_145640
• Gene Symbol: APOL3
• Gene ID (NCBI): 80833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95236
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Apolipoprotein L3(APOL3) is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. APOL3 is localized in the cytoplasm and plays a central role in cholesterol transport, affecting the movement of lipids, including cholesterol, and allowing the binding of lipids to organelles.