CoraLite® Plus 647 Anti-Mouse APRIL/TNFSF13 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• CoraLite® Plus 647 Anti-Mouse APRIL/TNFSF13 Rabbit Recombinant Antibody (CL647-98331-2)

APRIL/TNFSF13 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. CL647-98331-2 Copied!

Clone No. 241666F9

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

241666F9, A proliferation-inducing ligand, APRIL, CD256, Tnfsf13

• 

  FC experiment of Transfected HEK-293T using CL647-98331-2

  1x10^6 HEK-293T cells or APRIL/TNFSF13 transfected HEK-293T cells were intracellularly stained with 0.25 ug CoraLite® Plus 647 Anti-Mouse APRIL/TNFSF13 Rabbit RecAb (CL647-98331-2, Clone: 241666F9). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using CL647-98331-2

  1x10^6 HEK-293T cells or APRIL/TNFSF13 transfected HEK-293T cells were intracellularly stained with 0.25 ug CoraLite® Plus 647 Anti-Mouse APRIL/TNFSF13 Rabbit RecAb (CL647-98331-2, Clone: 241666F9) (red) or 0.25 ug CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-98136, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for APRIL/TNFSF13 in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98331-2 targets APRIL/TNFSF13 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1561

  Product name: Recombinant Mouse APRIL/TNFSF13 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 96-241 aa of NM_023517.2

  Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL

• Full Name: tumor necrosis factor (ligand) superfamily, member 13
• Calculated Molecular Weight: 27kDa
• GenBank Accession Number: NM_023517.2
• Gene Symbol: Tnfsf13
• Gene ID (NCBI): 69583
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9D777
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TNFSF13 gene encodes tumor necrosis factor ligand superfamily member 13 (or APRIL) belonging to the tumor necrosis factor (TNF) family. APRIL is highly expressed in transformed cell lines, cancers of colon, thyroid, lymphoid tissues and specifically expressed in monocytes and macrophages, and its precursor is cleaved by furin. APRIL may be implicated in the regulation of tumor cell growth and also monocyte/macrophage-mediated immunological processes.