AQP1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• AQP1 Recombinant monoclonal antibody (81137-2-RR)

AQP1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 81137-2-RR

Clone No.251798B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

Aquaporin 1, AQP 1, AQP-1, Aquaporin1, Aquaporin-1

• 

  WB analysis of mouse kidney using 81137-2-RR

  Mouse kidney total extract lysate and membrane extract lysate were subjected to SDS PAGE followed by western blot with 81137-2-RR (AQP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat kidney using 81137-2-RR

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 81137-2-RR (AQP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 81137-2-RR

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 81137-2-RR (AQP1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 81137-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 81137-2-RR (AQP1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 81137-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 81137-2-RR (AQP1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse kidney using 81137-2-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using AQP1 antibody (81137-2-RR, Clone: 251798B1 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 81137-2-RR

  Biolayer interferometry (BLl) kinetic assays of 81137-2-RR against Human AQP1 were performed. The affinity constant is 6.13 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: mouse kidney tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81137-2-RR targets AQP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14093

  Product name: Recombinant human AQP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-269 aa of BC022486

  Sequence: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

• Full Name: aquaporin 1 (Colton blood group)
• Calculated Molecular Weight: 269 aa, 29 kDa
• Observed Molecular Weight: 25-28 kDa, 35-50 kDa
• GenBank Accession Number: BC022486
• Gene Symbol: AQP1
• Gene ID (NCBI): 358
• RRID: AB_3743368
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29972
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AQP1 is a member of aquaporins (AQPs) that are small membrane-spanning proteins facilitating water transport. AQP1 is expressed in most tissues in the mammalian body. Alterations of AQP1 expression have been linked to variety of diseases, including cancer. The predicted molecular weight of AQP1 is around 28 kDa, while highly glycosylated form can also be observed around 35-50 kDa. (PMID:20965731,16508653, 1530176).