AREG Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP02406-2

  Urine of six individual healthy human donors was measured. The Amphiregulin concentration of detected samples was determined to be 7.4 ng/mL with a range of 2.3-12.5 ng/mL.

• 

  Sandwich ELISA sample test of MP02406-2

  Saliva of six individual healthy human donors was measured. The Amphiregulin concentration of detected samples was determined to be 95.9 ng/mL with a range of 22.9-168.9 ng/mL.

• 

  Sandwich ELISA sample test of MP02406-2

  MDA-MB-453 were cultured in DMEM supplemented with 10% fetal bovine serum, 2.5 mM L-glutamine, 100 U/mL penicillin, and 100 μg/mL streptomycin sulfate. An aliquot of the cell culture supernate was removed, assayed for human Amphiregulin, and measured 915.6 pg/mL.

• 

  Sandwich ELISA sample test of MP02406-2

  The mean Amphiregulin concentration was determined to be 378.9 ng/mL in MDA-MB-453 cell extract based on a 1.8 mg/mL extract load.

• 

  Sandwich ELISA sample test of MP02406-2

  Plasma of eight individual healthy human donors was measured. The Amphiregulin concentration of detected samples was determined to be 15.22 pg/mL with a range of 6.47-20.52 pg/mL.

• 

  Sandwich ELISA standard curve of MP02406-2

  Sandwich ELISA standard curve of MP02406-2, Human Amphiregulin Recombinant Matched Antibody Pair - PBS only. 86387-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg4569. 86387-1-PBS was HRP conjugated as the detection antibody. Range: 15.6-1000 pg/mL.

• 

  Affinity and Kinetic Characterization of 86387-3-PBS

  Biolayer interferometry (BLl) kinetic assays of 86387-3-PBS against Human AREG were performed. The affinity constant is 3.54 pM.

• 

  Affinity and Kinetic Characterization of 86387-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86387-3-RR against Human AREG were performed. The affinity constant is 3.54 pM.

AREG Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 86387-3-PBS

Clone No.250996B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

Amphiregulin, AR, AREGB, Colorectum cell-derived growth factor, CRDGF

---

Product Information

86387-3-PBS targets AREG as part of a matched antibody pair:

MP02406-2: 86387-3-PBS capture and 86387-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4569

  Product name: Recombinant Human Amphiregulin protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 101-187 aa of NM_001657.3

  Sequence: SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMK

• Full Name: amphiregulin
• Calculated Molecular Weight: 28 kDa
• GenBank Accession Number: NM_001657.3
• Gene Symbol: Amphiregulin/AREG
• Gene ID (NCBI): 374
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15514
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.