ARF1 Monoclonal antibody, PBS Only

ARF1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68069-1-PBS
Clone No.1C10E3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, Indirect ELISA

1C10E3, ADP ribosylation factor 1, ADP-ribosylation factor 1, EC:3.6.5.2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68069-1-PBS targets ARF1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28021

Product name: Recombinant human ARF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-181 aa of BC009247

Sequence: MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Predict reactive species
Full Name ADP-ribosylation factor 1
Calculated Molecular Weight 21 kDa
Observed Molecular Weight18-21 kDa
GenBank Accession NumberBC009247
Gene Symbol ARF1
Gene ID (NCBI) 375
RRIDAB_2918810
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP84077
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. It mainly functions in coat recruitment.(PMID: 7759471, PMID: 16042562).

Loading...
||
New chat Able
正在加载,请稍候...