ARF5 Monoclonal antibody, PBS Only

• 

  WB analysis using 67279-1-Ig (same clone as 67279-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67279-1-Ig (ARF5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67279-1-Ig (same clone as 67279-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67279-1-Ig (ARF5 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67279-1-Ig (same clone as 67279-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67279-1-Ig (ARF5 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 67279-1-Ig (same clone as 67279-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67279-1-Ig (ARF5 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67279-1-PBS in a different storage buffer formulation.

ARF5 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67279-1-PBS

Clone No.2B3B1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

WB, Indirect ELISA

Synonyms

ADP ribosylation factor 5, ARF5

---

Product Information

67279-1-PBS targets ARF5 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat, pig samples.

• Tested Reactivity: Human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7849

  Product name: Recombinant human ARF5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-180 aa of BC003043

  Sequence: MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

• Full Name: ADP-ribosylation factor 5
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC003043
• Gene Symbol: ARF5
• Gene ID (NCBI): 381
• RRID: AB_2882547
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P84085
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.