ARFGEF2 Recombinant monoclonal antibody, PBS Only (Detector)

ARFGEF2 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 84296-4-PBS
Clone No.241538H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

BIG2, 241538H5, ARFGEP2, Brefeldin A inhibited GEP 2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84296-4-PBS targets ARFGEF2 as part of a matched antibody pair:

MP01199-3: 84296-5-PBS capture and 84296-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35396

Product name: Recombinant human ARFGEF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 211-370 aa of BC050449

Sequence: PIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKEAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGIADDRQSLSSADNLESDAQGHQVAARFSHVL

Predict reactive species
Full Name ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited)
Observed Molecular Weight202 kDa
GenBank Accession NumberBC050449
Gene Symbol ARFGEF2
Gene ID (NCBI) 10564
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y6D5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. ARFGEF2 is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP and is involved in Golgi transport. ARFGEF2 contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition.

Loading...
||
New chat Able
正在加载,请稍候...