Arfaptin-1 Polyclonal antibody

• 

  WB analysis using 17726-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17726-1-AP (Arfaptin-1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 17726-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17726-1-AP (ARFIP1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 17726-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17726-1-AP (ARFIP1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas using 17726-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 17726-1-AP (ARFIP1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human pancreas using 17726-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 17726-1-AP (ARFIP1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 17726-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Arfaptin-1 antibody (17726-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HepG2 using 17726-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug Arfaptin-1 Polyclonal antibody (17726-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

Arfaptin-1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 17726-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

ARFIP1, ADP-ribosylation factor-interacting protein 1, Arfaptin 1

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HCT 116 cells, HeLa cells, HepG2 cells, Jurkat cells, Raw 264.7 cells, mouse brain tissue
• Positive IHC detected in: human breast cancer tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

17726-1-AP targets Arfaptin-1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12122

  Product name: Recombinant human ARFIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-373 aa of BC103759

  Sequence: MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWLEEQ

• Full Name: ADP-ribosylation factor interacting protein 1
• Calculated Molecular Weight: 373 aa, 42 kDa
• Observed Molecular Weight: 42 kDa, 38 kDa, 22 kDa
• GenBank Accession Number: BC103759
• Gene Symbol: Arfaptin-1
• Gene ID (NCBI): 27236
• RRID: AB_2227457
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53367
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncotarget; Quantitative proteomics reveals molecular mechanism of gamabufotalin and its potential inhibition on Hsp90 in lung cancer.; Authors - Liyuan Zhang