ARGLU1 Polyclonal antibody

• 

  WB analysis using 28155-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28155-1-AP (ARGLU1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 28155-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 28155-1-AP (ARGLU1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ARGLU1 Polyclonal Antibody for WB, ELISA

Cat No. 28155-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, ELISA

Synonyms

arginine and glutamate rich 1, ARGLU1, DKFZp686O08106, FLJ10154

---

Tested Applications

• Positive WB detected in: HL-60 cells, HEK-293 cells, mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28155-1-AP targets ARGLU1 in WB, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28051

  Product name: Recombinant human ARGLU1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 63-191 aa of BC071587

  Sequence: TAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKARE

• Full Name: arginine and glutamate rich 1
• Calculated Molecular Weight: 273 aa, 33 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC071587
• Gene Symbol: ARGLU1
• Gene ID (NCBI): 55082
• RRID: AB_2881077
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWB6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Annabel (Verified Customer) (12-23-2025)

Produces a strong signal by western blot. Imaged using blotting accelerator

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: B Cells

ARGLU1 Antibody Western Blot validation (1:1000 dilution) in B Cells (Cat no:28155-1-AP)