ARHGAP4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARHGAP4 Polyclonal antibody, PBS Only (16697-1-PBS)

• 

  WB analysis using 16697-1-AP (same clone as 16697-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16697-1-AP (ARHGAP4 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16697-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HL-60 using 16697-1-AP (same clone as 16697-1-PBS)

  IP result of anti-ARHGAP4 (IP:16697-1-AP, 4ug; Detection:16697-1-AP 1:500) with HL-60 cells lysate 1000ug. This data was developed using the same antibody clone with 16697-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 16697-1-AP (same clone as 16697-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 16697-1-AP (ARHGAP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16697-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 16697-1-AP (same clone as 16697-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 16697-1-AP (ARHGAP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16697-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 16697-1-AP (same clone as 16697-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 16697-1-AP (ARHGAP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16697-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 16697-1-AP (same clone as 16697-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 16697-1-AP (ARHGAP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16697-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 16697-1-AP (same clone as 16697-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using ARHGAP4 antibody (16697-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16697-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 16697-1-AP (same clone as 16697-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using ARHGAP4 antibody (16697-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 16697-1-PBS in a different storage buffer formulation.

ARHGAP4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 16697-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

RhoGAP4, Rho-GAP hematopoietic protein C1, Rho GTPase-activating protein 4, RGC1, p115

---

Product Information

16697-1-PBS targets ARHGAP4 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10091

  Product name: Recombinant human ARHGAP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 714-986 aa of BC052303

  Sequence: VALQGRVNQLVQTLIVQPDRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNEPELEAEMPAQEDDLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH

• Full Name: Rho GTPase activating protein 4
• Calculated Molecular Weight: 986 aa, 109 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC052303
• Gene Symbol: ARHGAP4
• Gene ID (NCBI): 393
• RRID: AB_1850892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P98171
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.