ARHI Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARHI Polyclonal antibody, PBS Only (10811-2-PBS)

• 

  WB analysis using 10811-2-AP (same clone as 10811-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10811-2-AP (ARHI antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10811-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 10811-2-AP (same clone as 10811-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 10811-2-AP (ARHI antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10811-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 10811-2-AP (same clone as 10811-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 10811-2-AP (ARHI antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10811-2-PBS in a different storage buffer formulation.

ARHI Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 10811-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

10811-2-PBS targets ARHI in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1123

  Product name: Recombinant human DIRAS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-229 aa of BC005362

  Sequence: MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

• Full Name: DIRAS family, GTP-binding RAS-like 3
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC005362
• Gene Symbol: ARHI
• Gene ID (NCBI): 9077
• RRID: AB_2292774
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95661
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.