ARID1A Recombinant monoclonal antibody

• 

  WB analysis of BxPC-3 using 83733-3-RR

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 83733-3-RR (ARID1A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83733-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83733-3-RR (ARID1A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 83733-3-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 83733-3-RR (ARID1A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 83733-3-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 83733-3-RR (ARID1A antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 83733-3-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ARID1A antibody (83733-3-RR, Clone: 240690F1 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 83733-3-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ARID1A antibody (83733-3-RR, Clone: 240690F1 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 83733-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83733-3-RR against Human ARID1A were performed. The affinity constant is 0.462 nM.

ARID1A Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 83733-3-RR

Clone No.240690F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

BAF250A, BAF250, B120, AT-rich interactive domain-containing protein 1A, ARID domain-containing protein 1A

---

Tested Applications

• Positive WB detected in: MCF-7 cells, BxPC-3 cells, K-562 cells, HepG2 cells
• Positive IHC detected in: human colon cancer tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83733-3-RR targets ARID1A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30749

  Product name: Recombinant human ARID1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1230-1370 aa of NM_006015

  Sequence: KDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK

• Full Name: AT rich interactive domain 1A (SWI-like)
• Calculated Molecular Weight: 242 kDa
• Observed Molecular Weight: 250-260 kDa
• GenBank Accession Number: NM_006015
• Gene Symbol: ARID1A
• Gene ID (NCBI): 8289
• RRID: AB_3671333
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14497
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARID1A, also named as BAF250, BAF250A, C1orf4, OSA1 and SMARCF1, is involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). It binds DNA non-specifically. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. ARID1A belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The antibody is specific to ARID1A.