ARID1A Recombinant monoclonal antibody

ARID1A Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 83733-3-RR
Clone No.240690F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

BAF250A, BAF250, B120, AT-rich interactive domain-containing protein 1A, ARID domain-containing protein 1A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, BxPC-3 cells, K-562 cells, HepG2 cells
Positive IHC detected inhuman colon cancer tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:150-1:600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83733-3-RR targets ARID1A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30749

Product name: Recombinant human ARID1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1230-1370 aa of NM_006015

Sequence: KDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK

Predict reactive species
Full Name AT rich interactive domain 1A (SWI-like)
Calculated Molecular Weight 242 kDa
Observed Molecular Weight250-260 kDa
GenBank Accession NumberNM_006015
Gene Symbol ARID1A
Gene ID (NCBI) 8289
RRIDAB_3671333
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14497
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARID1A, also named as BAF250, BAF250A, C1orf4, OSA1 and SMARCF1, is involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). It binds DNA non-specifically. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. ARID1A belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The antibody is specific to ARID1A.

Protocols

Product Specific Protocols
IF protocol for ARID1A antibody 83733-3-RRDownload protocol
IHC protocol for ARID1A antibody 83733-3-RRDownload protocol
WB protocol for ARID1A antibody 83733-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...