CoraLite® Plus 488-conjugated ARID1A Recombinant monoclonal antibody

ARID1A Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83733-3
Clone No.240690F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

240690F1, ARID domain-containing protein 1A, AT-rich interactive domain-containing protein 1A, B120, BAF250

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83733-3 targets ARID1A in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30749

Product name: Recombinant human ARID1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1230-1370 aa of NM_006015

Sequence: KDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK

Predict reactive species
Full Name AT rich interactive domain 1A (SWI-like)
Calculated Molecular Weight 242 kDa
Observed Molecular Weight250-260 kDa
GenBank Accession NumberNM_006015
Gene Symbol ARID1A
Gene ID (NCBI) 8289
RRIDAB_3673297
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14497
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ARID1A, also named as BAF250, BAF250A, C1orf4, OSA1 and SMARCF1, is involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). It binds DNA non-specifically. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. ARID1A belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The antibody is specific to ARID1A.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ARID1A antibody CL488-83733-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...