ARL15 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARL15 Polyclonal antibody, PBS Only (11934-1-PBS)

• 

  WB analysis of mouse thymus using 11934-1-AP (same clone as 11934-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11934-1-AP (ARL15 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11934-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse thymus using 11934-1-AP (same clone as 11934-1-PBS)

  IP result of anti-ARL15 (IP:11934-1-AP, 4ug; Detection:11934-1-AP 1:300) with mouse thymus tissue lysate 4000 ug. This data was developed using the same antibody clone with 11934-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 11934-1-AP (same clone as 11934-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 11934-1-AP (ARL15 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11934-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ARL15 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11934-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

11934-1-PBS targets ARL15 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2530

  Product name: Recombinant human ARL15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-204 aa of BC026093

  Sequence: MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM

• Full Name: ADP-ribosylation factor-like 15
• Calculated Molecular Weight: 204 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC026093
• Gene Symbol: ARL15
• Gene ID (NCBI): 54622
• RRID: AB_2227438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXU5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ARL15(ADP-ribosylation factor-like protein 15) is also named as ARFRP2(ADP-ribosylation factor-related protein 2) and belongs to the small GTPase superfamily and Arf familiy.ADP-ribosylation factor-related protein (ARP) is a membrane-associated GTPase with remote similarity to the family of ADP-ribosylation factors (ARF)(PMID:10092663). Arl15 is present in chordates but not lower eukaryotes. Arl15 lacks a site for Nmyristoylation, but the N-terminal region contains several well-conserved cysteines, suggesting that it may bepalmitoylated(PMID:17506703).