CoraLite®594-conjugated ARL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite®594-conjugated ARL2 Polyclonal antibody (CL594-10232)

• Featured Product
• KD/KO Validated

ARL2 Polyclonal Antibody for IF-P

Cat No. CL594-10232

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

ADP ribosylation factor like 2, ADP-ribosylation factor-like protein 2

• 

  IF Staining of human ovary cancer using CL594-10232

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human ovary cancer tissue using CoraLite®594 ARL2 antibody (CL594-10232) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF-P detected in: human ovary cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-10232 targets ARL2 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0334

  Product name: Recombinant human ARL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-184 aa of BC002530

  Sequence: GLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD

• Full Name: ADP-ribosylation factor-like 2
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21-25 kDa
• GenBank Accession Number: BC002530
• Gene Symbol: ARL2
• Gene ID (NCBI): 402
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Antigen Affinity Purified
• UNIPROT ID: P36404
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The ADP-ribosylation factor (ARF) genes are small GTP-binding proteins of the RAS superfamily. ADP-ribosylation factor-like 2 (ARL2) is a member of a functionally distinct group of ARF-like genes. ARL2 interacts with the tubulin-specific chaperone protein known as cofactor D. ARL2 downregulates the tubulin GAP activity of cofactor C, D, and E, and inhibits the binding of D to native tubulin.