ARL2BP Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 67316-1-Ig (same clone as 67316-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67316-1-Ig (ARL2BP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67316-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67316-1-Ig (same clone as 67316-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67316-1-Ig (ARL2BP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67316-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67316-1-Ig (same clone as 67316-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67316-1-Ig (ARL2BP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67316-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51684-1

  Cytometric bead array sample test of MP51684-1, ARL2BP Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67316-1-PBS. Detection antibody: 67316-2-PBS.

• 

  Cytometric bead array standard curve of MP51684-1

  Cytometric bead array standard curve of MP51684-1, ARL2BP Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67316-1-PBS. Detection antibody: 67316-2-PBS. Standard:Ag29261. Range: 0.391-50 ng/mL.

ARL2BP Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 67316-1-PBS

Clone No.1G5C2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

1G5C2, ADP-ribosylation factor-like protein 2-binding protein, ARF-like 2-binding protein, BART, BART1

---

Product Information

67316-1-PBS targets ARL2BP as part of a matched antibody pair:

MP51684-1: 67316-1-PBS capture and 67316-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29261

  Product name: Recombinant human ARL2BP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC003087

  Sequence: MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

• Full Name: ADP-ribosylation factor-like 2 binding protein
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC003087
• Gene Symbol: ARL2BP
• Gene ID (NCBI): 23568
• RRID: AB_2882576
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y2Y0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.