CoraLite®594-conjugated ARL2BP Monoclonal antibody

• 

  IF Staining of U2OS using CL594-67316

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CoraLite®594 ARL2BP antibody (CL594-67316, Clone: 1G5C2 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL594-67316

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human ARL2BP (CL594-67316, Clone:1G5C2) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

ARL2BP Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-67316

Clone No.1G5C2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

RP66, BART1, BART, ARF-like 2-binding protein, ADP-ribosylation factor-like protein 2-binding protein

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67316 targets ARL2BP in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29261

  Product name: Recombinant human ARL2BP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC003087

  Sequence: MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

• Full Name: ADP-ribosylation factor-like 2 binding protein
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC003087
• Gene Symbol: ARL2BP
• Gene ID (NCBI): 23568
• RRID: AB_3084759
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y2Y0
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.