ARL3 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 68421-1-Ig (same clone as 68421-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 68421-1-Ig (ARL3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68421-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit testis using 68421-1-Ig (same clone as 68421-1-PBS)

  rabbit testis tissue were subjected to SDS PAGE followed by western blot with 68421-1-Ig (ARL3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68421-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat retina using 68421-1-Ig (same clone as 68421-1-PBS)

  rat retina tissue were subjected to SDS PAGE followed by western blot with 68421-1-Ig (ARL3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68421-1-PBS in a different storage buffer formulation.

• 

  IF Staining of hTERT-RPE1 using 68421-1-Ig (same clone as 68421-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed hTERT-RPE1 cells using ARL3 antibody (68421-1-Ig, Clone: 2E5B12 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 68421-1-PBS in a different storage buffer formulation.

ARL3 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68421-1-PBS

Clone No.2E5B12

Host / Isotype

Mouse / IgG2b

Reactivity

Human, rat, rabbit

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ADP ribosylation factor like 3, ARFL3, ARL3

---

Product Information

68421-1-PBS targets ARL3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, rat, rabbit samples.

• Tested Reactivity: Human, rat, rabbit
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21387

  Product name: Recombinant human ARL3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-182 aa of BC009841

  Sequence: MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK

• Full Name: ADP-ribosylation factor-like 3
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20-24 kDa
• GenBank Accession Number: BC009841
• Gene Symbol: ARL3
• Gene ID (NCBI): 403
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36405
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ARL3 (ADP-ribosylation factor-like 3) is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. ARL3 is believed to be involved in ciliary and microtubule-dependent processes.