ARL6IP6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARL6IP6 Polyclonal antibody, PBS Only (16956-1-PBS)

• 

  WB analysis of Jurkat using 16956-1-AP (same clone as 16956-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16956-1-AP (ARL6IP6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16956-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 16956-1-AP (same clone as 16956-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 16956-1-AP (ARL6IP6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16956-1-AP (same clone as 16956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16956-1-AP (ARL6IP6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16956-1-AP (same clone as 16956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16956-1-AP (ARL6IP6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16956-1-PBS in a different storage buffer formulation.

ARL6IP6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16956-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

16956-1-PBS targets ARL6IP6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10598

  Product name: Recombinant human ARL6IP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-110 aa of BC028741

  Sequence: MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLS

• Full Name: ADP-ribosylation-like factor 6 interacting protein 6
• Calculated Molecular Weight: 226 aa, 25 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: BC028741
• Gene Symbol: ARL6IP6
• Gene ID (NCBI): 151188
• RRID: AB_2058995
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N6S5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.