ARMC7 Polyclonal antibody

• 

  IHC staining of human pancreas using 24029-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 24029-1-AP (ARMC7 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas using 24029-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 24029-1-AP (ARMC7 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human cervical cancer using 24029-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 24029-1-AP (ARMC7 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human cervical cancer using 24029-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 24029-1-AP (ARMC7 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of U2OS using 24029-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using 24029-1-AP (ARMC7 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated Goat Anti-Rabbit IgG(H+L).

ARMC7 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 24029-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

Armadillo repeat-containing protein 7, armadillo repeat containing 7

---

Tested Applications

• Positive IHC detected in: human pancreas tissue, human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24029-1-AP targets ARMC7 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21222

  Product name: Recombinant human ARMC7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC011728

  Sequence: MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQR

• Full Name: armadillo repeat containing 7
• Calculated Molecular Weight: 198 aa, 22 kDa
• GenBank Accession Number: BC011728
• Gene Symbol: ARMC7
• Gene ID (NCBI): 79637
• RRID: AB_2879408
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6L4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.