CDNF Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CDNF Polyclonal antibody (25035-1-AP)

• 

  WB analysis of mouse testis using 25035-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25035-1-AP (ARMETL1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 25035-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25035-1-AP (ARMETL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 25035-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25035-1-AP (ARMETL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CDNF Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25035-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ARMETL1, ARMET like protein 1, ARMET-like protein 1

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25035-1-AP targets CDNF in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18972

  Product name: Recombinant human ARMETL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 103-187 aa of BC133042

  Sequence: MSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

• Full Name: arginine-rich, mutated in early stage tumors-like 1
• Calculated Molecular Weight: 187 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC133042
• Gene Symbol: ARMETL1
• Gene ID (NCBI): 441549
• RRID: AB_2879861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q49AH0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cerebral dopamine neurotrophic factor (CDNF) is a secreted protein belonging to the mesencephalic astrocyte-derived neurotrophic factor (MANF) family. Unlike classical neurotrophic factors, CDNF is primarily localized in the endoplasmic reticulum and exerts neuroprotective effects through modulating the unfolded protein response (UPR). CDNF has demonstrated potent protective effects on dopaminergic neurons in preclinical models of Parkinson's disease (PD), reducing neuroinflammation and alpha-synuclein aggregation. Its unique mechanism-targeting ER stress rather than receptor tyrosine kinases-offers a promising therapeutic avenue for neurodegenerative disorders. Clinical trials are currently evaluating recombinant human CDNF as a disease-modifying therapy for PD (PMID: 34284712; 37555005; 38290651).