ARMS2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARMS2 Polyclonal antibody, PBS Only (33334-1-PBS)

• 

  IHC staining of mouse eye using 33334-1-AP (same clone as 33334-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 33334-1-AP (ARMS2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33334-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse eye using 33334-1-AP (same clone as 33334-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 33334-1-AP (ARMS2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33334-1-PBS in a different storage buffer formulation.

ARMS2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 33334-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

Age-related maculopathy susceptibility protein 2

---

Product Information

33334-1-PBS targets ARMS2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37837

  Product name: Recombinant human ARMS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-107 aa of NM_001099667

  Sequence: MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR

• Full Name: age-related maculopathy susceptibility 2
• Calculated Molecular Weight: 107aa, 11 kDa
• GenBank Accession Number: NM_001099667
• Gene Symbol: ARMS2
• Gene ID (NCBI): 387715
• RRID: AB_3742943
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0C7Q2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Age-related maculopathy susceptibility 2 (ARMS2) is a small (11 kDa), primate-specific protein found in the extracellular matrix of the choroid layer in the eye. Variants in the corresponding genetic locus are highly associated with age-related macular degeneration, a leading cause of blindness in the elderly (PMID: 27270414).