ARNT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARNT2 Polyclonal antibody, PBS Only (12810-1-PBS)

• 

  WB analysis of Jurkat using 12810-1-AP (same clone as 12810-1-PBS)

  WB result of ARNT2 antibody (12810-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ARNT2 transfected Jurkat cells. This data was developed using the same antibody clone with 12810-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 12810-1-AP (same clone as 12810-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12810-1-AP (ARNT2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12810-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 12810-1-AP (same clone as 12810-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 12810-1-AP (ARNT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12810-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 12810-1-AP (same clone as 12810-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12810-1-AP (ARNT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12810-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 12810-1-AP (same clone as 12810-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12810-1-AP (ARNT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12810-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12810-1-AP (same clone as 12810-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12810-1-AP (ARNT2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12810-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12810-1-AP (same clone as 12810-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12810-1-AP (ARNT2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12810-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ARNT2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12810-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12810-1-PBS targets ARNT2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3536

  Product name: Recombinant human ARNT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 363-716 aa of BC036099

  Sequence: QDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPGNEWWSPHSRQHFRQPISYARM

• Full Name: aryl-hydrocarbon receptor nuclear translocator 2
• Calculated Molecular Weight: 716 aa, 79 kDa
• Observed Molecular Weight: 80-85 kDa
• GenBank Accession Number: BC036099
• Gene Symbol: ARNT2
• Gene ID (NCBI): 9915
• RRID: AB_2059456
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBZ2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Aryl-hydrocarbon receptor nuclear translocator 2(ARNT2), is a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. It specifically recognizes the xenobiotic response element(XRE). ARNT2 plays an important role in normal glucose handling in pancreatic beta cell function in humans and mice. ARNT2 proteins are dimeric partners for other PAS proteins such as HIF and SIM. ARNT2 and the other ARNT family members, e.g., ARNT, hypoxin inducible factor 1α (HIF1α), HIF2α, and aryl hydrocarbon receptor (AhR), are thought to function as heterodimers, and regulate the expression, and thereby the function, of many genes. Under hypoxic conditions, it complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. Modulation of ARNT2 in pancreatic beta cells affects glucose stimulated INS secretion (GSIS). This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human ARNT2.