ARP3/ARP3B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARP3/ARP3B Polyclonal antibody, PBS Only (13822-1-PBS)

• 

  WB analysis using 13822-1-AP (same clone as 13822-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13822-1-AP (ARP3/ARP3B antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13822-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spleen using 13822-1-AP (same clone as 13822-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 13822-1-AP (ARP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13822-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 13822-1-AP (same clone as 13822-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 13822-1-AP (ARP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13822-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse spleen using 13822-1-AP (same clone as 13822-1-PBS)

  IP result of anti-ARP3/ARP3B (IP:13822-1-AP, 4ug; Detection:13822-1-AP 1:1000) with mouse spleen tissue lysate 4000ug. This data was developed using the same antibody clone with 13822-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 13822-1-AP (same clone as 13822-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13822-1-AP (ARP3/ARP3B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13822-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ARP3/ARP3B Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13822-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

13822-1-PBS targets ARP3/ARP3B in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4922

  Product name: Recombinant human ACTR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 156-418 aa of BC044590

  Sequence: RQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

• Full Name: ARP3 actin-related protein 3 homolog (yeast)
• Calculated Molecular Weight: 418 aa 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC044590
• Gene Symbol: ARP3/ACTR3
• Gene ID (NCBI): 10096
• RRID: AB_2221967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61158
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ARP3 (also known as ACTR3) is a major constituent of the ARP2/3 complex that is necessary for nucleating actin polymerization at filament branches. ARP3 localizes to the lamellipodia of stationary and locomoting fibroblasts. Overexpression of ARP3 has been reported in several types of cancer cells. This antibody recognizes endogenous ARP3 and may cross-react with ATCR3B.