CoraLite® Plus 488-conjugated ARP3/ARP3B Monoclonal antibody

ARP3/ARP3B Monoclonal Antibody for IF/ICC
Cat No. CL488-68439
Clone No.1D12C7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

IF/ICC

ACTR3, ARP3, Actin like protein 3, Actin related protein 3, Actin-like protein 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHUVEC cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68439 targets ARP3/ARP3B in IF/ICC applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5017

Product name: Recombinant human ACTR3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 156-418 aa of BC044590

Sequence: RQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

Predict reactive species
Full Name ARP3 actin-related protein 3 homolog (yeast)
Calculated Molecular Weight 418 aa 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC044590
Gene Symbol ARP3/ACTR3
Gene ID (NCBI) 10096
RRIDAB_3673015
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP61158
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ARP3 (also known as ACTR3) is a major constituent of the ARP2/3 complex that is necessary for nucleating actin polymerization at filament branches. ARP3 localizes to the lamellipodia of stationary and locomoting fibroblasts. Overexpression of ARP3 has been reported in several types of cancer cells. This antibody recognizes endogenous ARP3 and may cross-react with ATCR3B.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ARP3/ARP3B antibody CL488-68439Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...