ARPC1B Polyclonal antibody

• 

  WB analysis of HeLa using 28368-1-AP

  WB result of ARPC1B antibody (28368-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ARPC1B transfected HeLa cells.

• 

  WB analysis using 28368-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28368-1-AP (ARPC1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 28368-1-AP

  IP result of anti-ARPC1B (IP:28368-1-AP, 4ug; Detection:28368-1-AP 1:1000) with HeLa cells lysate 1600 ug.

• 

  IHC staining of human colon cancer using 28368-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28368-1-AP (ARPC1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 28368-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28368-1-AP (ARPC1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 28368-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28368-1-AP (ARPC1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 28368-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 28368-1-AP (ARPC1B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 28368-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28368-1-AP (ARPC1B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

ARPC1B Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 28368-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

Synonyms

Actin-related protein 2/3 complex subunit 1B, ARC41, p41 ARC, p41-ARC

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293T cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human colon cancer tissue, human lung cancer tissue, mouse brain tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IHC: See 2 publications below
• IP: See 1 publications below

Product Information

28368-1-AP targets ARPC1B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29001

  Product name: Recombinant human ARPC1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 265-372 aa of BC007555

  Sequence: CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK

• Full Name: actin related protein 2/3 complex, subunit 1B, 41kDa
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC007555
• Gene Symbol: ARPC1B
• Gene ID (NCBI): 10095
• RRID: AB_2881125
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15143
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARPC1B also known as ARC41, p41-ARC, or p40-ARC, is one of seven subunits of the human Arp2/3 protein complex, that belongs to the SOP2 family. ARPC1B localizes on centrosomes and has a distinct role in centrosomal homeostasis. ARPC1B is both a physiological activator and substrate of Aurora A kinase, and these interactions help to maintain mitotic integrity in mammalian cells. In recent resaeach, ARPC1B is selected as a candidate prediction marker for sensitivity of Choroidal malignant melanomas to radiotherapy.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Mol Cell Probes; High expression of ARPC1B promotes the proliferation and Apoptosis of clear cell renal cell carcinoma cells, leading to a poor prognosis; Authors - Hongbo Wang ; KD Validated
human	IHC	J Transl Med; A multi-dimensional approach to unravel the intricacies of lactylation related signature for prognostic and therapeutic insight in colorectal cancer; Authors - Huixia Huang
mouse,human	WB	Front Immunol; The overexpression of actin related protein 2/3 complex subunit 1B(ARPC1B) promotes the ovarian cancer progression via activation of the Wnt/β-catenin signaling pathway; Authors - Junning Huang
human	WB,IP	Nat Struct Mol Biol; Akt-phosphorylated UFL1 UFMylates ArpC4 to promote metastasis; Authors - Kailiang Zhao
mouse	WB	CNS Neurosci Ther; Integrated Mendelian Randomization and Single-Cell Transcriptomics Analysis Identifies Critical Blood Biomarkers and Potential Mechanisms in Epilepsy; Authors - Jianwei Shi