ARPC3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARPC3 Polyclonal antibody, PBS Only (14652-1-PBS)

• 

  WB analysis of HeLa using 14652-1-AP (same clone as 14652-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14652-1-AP (ARPC3 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14652-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 14652-1-AP (same clone as 14652-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14652-1-AP (ARPC3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14652-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 14652-1-AP (same clone as 14652-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14652-1-AP (ARPC3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14652-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 14652-1-AP (same clone as 14652-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 14652-1-AP (ARPC3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14652-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 14652-1-AP (same clone as 14652-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 14652-1-AP (ARPC3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14652-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ARPC3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14652-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14652-1-PBS targets ARPC3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6249

  Product name: Recombinant human ARPC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-178 aa of BC067747

  Sequence: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ

• Full Name: actin related protein 2/3 complex, subunit 3, 21kDa
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC067747
• Gene Symbol: ARPC3
• Gene ID (NCBI): 10094
• RRID: AB_2059933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15145
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.