ARRDC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARRDC1 Polyclonal antibody, PBS Only (21030-1-PBS)

• 

  WB analysis using 21030-1-AP (same clone as 21030-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21030-1-AP (ARRDC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21030-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 21030-1-AP (same clone as 21030-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 21030-1-AP (ARRDC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21030-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 21030-1-AP (same clone as 21030-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 21030-1-AP (ARRDC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21030-1-PBS in a different storage buffer formulation.

ARRDC1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21030-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Alpha-arrestin 1, arrestin domain containing 1, Arrestin domain-containing protein 1

---

Product Information

21030-1-PBS targets ARRDC1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15341

  Product name: Recombinant human ARRDC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 84-433 aa of BC032346

  Sequence: HSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRFSKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVGQALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHEQILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPVSPRPGLGLPPGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLSSVPGAPEPCPQDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQSCGGVEPSLTPES

• Full Name: arrestin domain containing 1
• Calculated Molecular Weight: 433 aa, 46 kDa
• Observed Molecular Weight: 46-50 kDa
• GenBank Accession Number: BC032346
• Gene Symbol: ARRDC1
• Gene ID (NCBI): 92714
• RRID: AB_3085633
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N5I2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ARRDC1, or Arrestin-Domain Containing Protein 1, is a protein that plays a significant role in the formation and release of extracellular vesicles, specifically a subtype known as ARMMs (Arrestin-Domain Containing Protein 1-mediated microvesicles). ARRDC1 is localized to the cytosolic side of the plasma membrane and recruits the ESCRT-I complex protein TSG101 to initiate outward membrane budding. This protein is also involved in the regulation of protein cargo and release of extracellular vesicles, including both exosomes and ectosomes. The absence of ARRDC1 can lead to changes in the protein cargo within these vesicles, indicating its importance in the sorting and packaging process.