ARRDC1 Recombinant monoclonal antibody, PBS Only

ARRDC1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 84874-5-PBS
Clone No.242396A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

242396A5, Alpha-arrestin 1, arrestin domain containing 1, Arrestin domain-containing protein 1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84874-5-PBS targets ARRDC1 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15341

Product name: Recombinant human ARRDC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 84-433 aa of BC032346

Sequence: HSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRFSKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVGQALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHEQILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPVSPRPGLGLPPGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLSSVPGAPEPCPQDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQSCGGVEPSLTPES

Predict reactive species
Full Name arrestin domain containing 1
Calculated Molecular Weight 433 aa, 46 kDa
Observed Molecular Weight46-50 kDa
GenBank Accession NumberBC032346
Gene Symbol ARRDC1
Gene ID (NCBI) 92714
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N5I2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ARRDC1, or Arrestin-Domain Containing Protein 1, is a protein that plays a significant role in the formation and release of extracellular vesicles, specifically a subtype known as ARMMs (Arrestin-Domain Containing Protein 1-mediated microvesicles). ARRDC1 is localized to the cytosolic side of the plasma membrane and recruits the ESCRT-I complex protein TSG101 to initiate outward membrane budding. This protein is also involved in the regulation of protein cargo and release of extracellular vesicles, including both exosomes and ectosomes. The absence of ARRDC1 can lead to changes in the protein cargo within these vesicles, indicating its importance in the sorting and packaging process.

Loading...
||
New chat Able
正在加载,请稍候...