Product Information
25060-1-PBS targets ARRDC3 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18717 Product name: Recombinant human ARRDC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-122 aa of BC053619 Sequence: DCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWTESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQTP Predict reactive species |
| Full Name | arrestin domain containing 3 |
| Calculated Molecular Weight | 414 aa, 46 kDa |
| Observed Molecular Weight | 46 kDa |
| GenBank Accession Number | BC053619 |
| Gene Symbol | ARRDC3 |
| Gene ID (NCBI) | 57561 |
| RRID | AB_2879878 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96B67 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ARRDC3 (Arrestin domain-containing protein 3) is an adaptor protein involved in modulating the cell-surface abundance of adrenergic receptors and likely other G protein-coupled receptors. It participates in NEDD4-dependent ubiquitination, endocytosis, and subsequent degradation of activated ADRB2. ARRDC3 may recruit NEDD4 to ADRB2; alternatively, it may act as an adaptor that contributes to endosomal targeting of ADRB2 rather than serving as a primary mediator for NEDD4 recruitment to this receptor (PMID: 20559325; 21982743; 23208550).
