ARTS1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARTS1 Polyclonal antibody, PBS Only (13821-1-PBS)

• 

  WB analysis of K-562 using 13821-1-AP (same clone as 13821-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 13821-1-AP (ARTS1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13821-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 13821-1-AP (same clone as 13821-1-PBS)

  IP result of anti-ARTS1 (IP:13821-1-AP, 4ug; Detection:13821-1-AP 1:600) with Jurkat cells lysate 3600ug. This data was developed using the same antibody clone with 13821-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 13821-1-AP (same clone as 13821-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 13821-1-AP (ARTS1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13821-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 13821-1-AP (same clone as 13821-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 13821-1-AP (ARTS1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13821-1-PBS in a different storage buffer formulation.

ARTS1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13821-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

13821-1-PBS targets ARTS1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4918

  Product name: Recombinant human ERAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 642-941 aa of BC030775

  Sequence: NAFQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTEGWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM

• Full Name: endoplasmic reticulum aminopeptidase 1
• Calculated Molecular Weight: 107 kDa
• Observed Molecular Weight: 106 kDa
• GenBank Accession Number: BC030775
• Gene Symbol: ARTS1/ERAP1
• Gene ID (NCBI): 51752
• RRID: AB_2293531
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZ08
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ARTS1 is an endoplasmic reticulum-associated aminopeptidase (also known as ERAP1). ERAP1 is induced by interferon-gama and can degrade peptides 9-15 residues long(PMID:18987748).ARTS1 is a 100 kDa, monomeric, soluble zinc aminopeptidase. It can be glycosylated to 120KDa and form homodimers and heterodimers(PMID:15908954).