ASAH1 Monoclonal antibody, PBS Only

ASAH1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 67092-2-PBS
Clone No.2B3C7

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig, rabbit

Applications

WB, IF/ICC, Indirect ELISA

ASAH, Acid ceramidase subunit beta, Acid ceramidase subunit alpha, Acid ceramidase, AC

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67092-2-PBS targets ASAH1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat, pig, rabbit samples.

Tested Reactivity human, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28645

Product name: Recombinant human ASAH1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-389 aa of BC016828

Sequence: MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTYPPSGPTVFPAVIRYRGAVPWYTINLDLPPYKRWHELMLDKAPVPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTVCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW

Predict reactive species
Full Name N-acylsphingosine amidohydrolase (acid ceramidase) 1
Calculated Molecular Weight 44 kDa
Observed Molecular Weight 44-55 kDa
GenBank Accession NumberBC016828
Gene Symbol ASAH1
Gene ID (NCBI) 427
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13510
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ASAH1, also named as AC, ACDase, Acid CDase, PHP32 and ASAH, belongs to the acid ceramidase family. ASAH1 is a lipid hydrolase that catalyzes the conversion of ceramide (cer) into sphingosine (SPH) and a free fatty acid. Mutation of ASAH1 will cause the Farber lipogranulomatosis (FL) which also known as Farber disease (FD). ASAH1 is highly expressed in Heart. And it is first synthesized as an 55-60 kDa precursor and subsequently processed to the mature, heterodimeric enzyme (40 + 13 kDa) in the endosomes/lysosomes.

Loading...
||
New chat Able
正在加载,请稍候...