ASCC3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ASCC3 Polyclonal antibody, PBS Only (17627-1-PBS)

• 

  WB analysis of HeLa using 17627-1-AP (same clone as 17627-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 17627-1-AP (ASCC3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17627-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 17627-1-AP (same clone as 17627-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 17627-1-AP (ASCC3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17627-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 17627-1-AP (same clone as 17627-1-PBS)

  IP result of anti-ASCC3 (IP:17627-1-AP, 4ug; Detection:17627-1-AP 1:400) with HeLa cells lysate 1080ug. This data was developed using the same antibody clone with 17627-1-PBS in a different storage buffer formulation.

ASCC3 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 17627-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

Helicase, ATP binding 1, HELIC1, EC:3.6.4.12, ASC1p200, ASC-1 complex subunit p200

---

Product Information

17627-1-PBS targets ASCC3 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11848

  Product name: Recombinant human ASCC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-111 aa of BC050681

  Sequence: MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR

• Full Name: activating signal cointegrator 1 complex subunit 3
• Calculated Molecular Weight: 111 aa, 13 kDa, 251 kDa
• Observed Molecular Weight: 251 kDa
• GenBank Accession Number: BC050681
• Gene Symbol: ASCC3
• Gene ID (NCBI): 10973
• RRID: AB_2059474
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N3C0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ASCC3 (Activating Signal Cointegrator 1 Complex Subunit 3) is a multifunctional protein involved in various cellular processes, including transcriptional regulation, DNA repair, and ribosome quality control. It is a member of the ASCC (Activating Signal Cointegrator 1 Complex) family, which functions as a bridge between co-repressors and co-activators in transcriptional regulation.