CoraLite® Plus 488-conjugated ASCC3 Recombinant monoclonal antibody

• 

  IF Staining of A431 using CL488-85130-2

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using CoraLite® Plus 488 ASCC3 antibody (CL488-85130-2, Clone: 242755B4 ) at dilution of 1:200.

ASCC3 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85130-2

Clone No.242755B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

Activating signal cointegrator 1 complex subunit 3, ASC-1 complex subunit p200, ASC1p200, EC:3.6.4.12, HELIC1

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85130-2 targets ASCC3 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11848

  Product name: Recombinant human ASCC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-111 aa of BC050681

  Sequence: MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR

• Full Name: activating signal cointegrator 1 complex subunit 3
• Calculated Molecular Weight: 111 aa, 13 kDa, 251 kDa
• Observed Molecular Weight: 245 kDa
• GenBank Accession Number: BC050681
• Gene Symbol: ASCC3
• Gene ID (NCBI): 10973
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N3C0
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ASCC3 (Activating Signal Cointegrator 1 Complex Subunit 3) is a multifunctional protein involved in various cellular processes, including transcriptional regulation, DNA repair, and ribosome quality control. It is a member of the ASCC (Activating Signal Cointegrator 1 Complex) family, which functions as a bridge between co-repressors and co-activators in transcriptional regulation.