ASF1A/B Polyclonal antibody, PBS Only

• 

  WB analysis of mouse thymus using 11011-1-AP (same clone as 11011-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11011-1-AP (ASF1B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11011-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 11011-1-AP (same clone as 11011-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11011-1-AP (ASF1B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11011-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 11011-1-AP (same clone as 11011-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11011-1-AP (ASF1B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11011-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 11011-1-AP (same clone as 11011-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11011-1-AP (ASF1B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11011-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 11011-1-AP (same clone as 11011-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11011-1-AP (ASF1A/B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11011-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 11011-1-AP (same clone as 11011-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11011-1-AP (ASF1A/B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11011-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 11011-1-AP (same clone as 11011-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ASF1A/B antibody (11011-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 11011-1-PBS in a different storage buffer formulation.

ASF1A/B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11011-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ASF1B, Anti-silencing function protein 1 homolog B, CCG1-interacting factor A-II, CIA II, CIA-II

---

Product Information

11011-1-PBS targets ASF1A/B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1477

  Product name: Recombinant human ASF1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-202 aa of BC010014

  Sequence: MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

• Full Name: ASF1 anti-silencing function 1 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 202 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC010014
• Gene Symbol: ASF1B
• Gene ID (NCBI): 55723
• RRID: AB_2059670
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVP2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. This antibody reacts with the ASF1B and ASF1A protein.