ASF1B-specific Polyclonal antibody

• 

  WB analysis using 22258-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22258-1-AP (ASF1B-specific antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 22258-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22258-1-AP (ASF1B-specific antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 22258-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 22258-1-AP (ASF1B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lymphoma using 22258-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22258-1-AP (ASF1B-specific antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 22258-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22258-1-AP (ASF1B-specific antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 22258-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22258-1-AP (ASF1B-specific antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 22258-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22258-1-AP (ASF1B-specific antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 22258-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ASF1B-specific antibody (22258-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

ASF1B-specific Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22258-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ChIP, ELISA

Synonyms

ASF1A/B, ASF1B, Anti-silencing function protein 1 homolog B, CCG1-interacting factor A-II, CIA II

---

Tested Applications

• Positive WB detected in: A431 cells, HEK-293 cells, HeLa cells
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• ChIP: See 1 publications below

Product Information

22258-1-AP targets ASF1B-specific in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17763

  Product name: Recombinant human ASF1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-202 aa of BC010014

  Sequence: INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

• Full Name: ASF1 anti-silencing function 1 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 202 aa, 22 kDa
• Observed Molecular Weight: 20-22 kDa
• GenBank Accession Number: BC010014
• Gene Symbol: ASF1B
• Gene ID (NCBI): 55723
• RRID: AB_2879051
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVP2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. This antibody specifically reacts with the 19kd ASF1B protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; RIF1-ASF1-mediated high-order chromatin structure safeguards genome integrity.; Authors - Sumin Feng ; KD Validated
mouse	WB,IF	Epigenetics Chromatin; Distinct role of histone chaperone Asf1a and Asf1b during fertilization and pre-implantation embryonic development in mice.; Authors - Xuemei Wang
human	ChIP	Cancer Lett; Activation of the FOXM1/ASF1B/PRDX3 axis confers hyperproliferative and antioxidative stress reactivity to gastric cancer; Authors - Zhou Zhao
mouse	WB	Int J Biol Macromol; Tannic acid protects against colitis by regulating the IL17 - NFκB and microbiota - methylation pathways; Authors - Minghui Wang
human	IHC	Tissue Cell; ASF1B is an essential prognostic indicator linked to the growth and resistance characteristics of bladder cancer; Authors - Peng Zhang
human	WB	bioRxiv; Mechanism of ASF1 Inhibition by CDAN1; Authors - Samantha F Sedor